SCOP 1.73: Domain d2nz9e2: 2nz9 E:115-215

Lineage for d2nz9e2 (2nz9 E:115-215)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d2nz9e2: 2nz9 E:115-215 [138845]
   Other proteins in same PDB: d2nz9c1, d2nz9d1, d2nz9d2, d2nz9e1, d2nz9f1, d2nz9f2
   automatically matched to d1egjl2
   complexed with ca, zn

Details for d2nz9e2

PDB Entry: 2nz9, 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2

PDB Compounds: (E:) AR2 monoclonal antibody

SCOP Domain Sequences for d2nz9e2:

Sequence; same for both SEQRES and ATOM records:

>d2nz9e2 b.1.1.2 (E:115-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
aapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2nz9e2:

• d2nz9e2 is new in SCOP 1.73
  
• d2nz9e2 appears in SCOP 1.75
  
• d2nz9e2 appears in the current release, SCOPe 2.08