Lineage for d2nz9e1 (2nz9 E:2-111)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511857Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 1511894Domain d2nz9e1: 2nz9 E:2-111 [138844]
    Other proteins in same PDB: d2nz9c2, d2nz9d1, d2nz9d2, d2nz9e2, d2nz9f1, d2nz9f2
    automatically matched to d1egjl1
    complexed with ca, zn

Details for d2nz9e1

PDB Entry: 2nz9 (more details), 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2
PDB Compounds: (E:) AR2 monoclonal antibody

SCOPe Domain Sequences for d2nz9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz9e1 b.1.1.1 (E:2-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
ivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlepg
iparfsgsgsgtdftltisslepedfavyycqqgnevpftfgqgtkveik

SCOPe Domain Coordinates for d2nz9e1:

Click to download the PDB-style file with coordinates for d2nz9e1.
(The format of our PDB-style files is described here.)

Timeline for d2nz9e1: