SCOPe 2.02: Domain d2nz9d2: 2nz9 D:119-218

Lineage for d2nz9d2 (2nz9 D:119-218)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2nz9d2: 2nz9 D:119-218 [138843]
   Other proteins in same PDB: d2nz9c1, d2nz9c2, d2nz9d1, d2nz9e1, d2nz9e2, d2nz9f1
   automatically matched to d1ngzb2
   complexed with ca, zn

Details for d2nz9d2

PDB Entry: 2nz9, 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2

PDB Compounds: (D:) AR2 monoclonal antibody

SCOPe Domain Sequences for d2nz9d2:

Sequence; same for both SEQRES and ATOM records:

>d2nz9d2 b.1.1.2 (D:119-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d2nz9d2:

• d2nz9d2 first appeared in SCOP 1.73
  
• d2nz9d2 appears in SCOPe 2.01
  
• d2nz9d2 appears in SCOPe 2.03
  
• d2nz9d2 appears in the current release, SCOPe 2.08