SCOP 1.73: Domain d2nz9d2: 2nz9 D:119-218

Lineage for d2nz9d2 (2nz9 D:119-218)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2nz9d2: 2nz9 D:119-218 [138843]
   Other proteins in same PDB: d2nz9c1, d2nz9c2, d2nz9d1, d2nz9e1, d2nz9e2, d2nz9f1
   automatically matched to d1ngzb2
   complexed with ca, zn

Details for d2nz9d2

PDB Entry: 2nz9, 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2

PDB Compounds: (D:) AR2 monoclonal antibody

SCOP Domain Sequences for d2nz9d2:

Sequence; same for both SEQRES and ATOM records:

>d2nz9d2 b.1.1.2 (D:119-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d2nz9d2:

• d2nz9d2 is new in SCOP 1.73
  
• d2nz9d2 appears in SCOP 1.75
  
• d2nz9d2 appears in the current release, SCOPe 2.08