Lineage for d2nyyd1 (2nyy D:2-118)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021586Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 2021637Domain d2nyyd1: 2nyy D:2-118 [138831]
    Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3, d2nyya4, d2nyyc1, d2nyyc2, d2nyyd2
    automatically matched to d1mhph1
    complexed with ca, zn

Details for d2nyyd1

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (D:) CR1 monoclonal antibody

SCOPe Domain Sequences for d2nyyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyyd1 b.1.1.1 (D:2-118) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
vqlqesggglvqpggslrlscaasgftfkydymywvrqapgkglewvatisdggsytyys
dsvegrfttsrdnskntlylqmnslraedtaiyycsryryddamdywgqgtlvtvss

SCOPe Domain Coordinates for d2nyyd1:

Click to download the PDB-style file with coordinates for d2nyyd1.
(The format of our PDB-style files is described here.)

Timeline for d2nyyd1: