SCOP 1.73: Domain d2nybd2: 2nyb D:83-192

Lineage for d2nybd2 (2nyb D:83-192)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Escherichia coli [TaxId:562] [54727] (6 PDB entries)

8. Domain d2nybd2: 2nyb D:83-192 [138811]
   Other proteins in same PDB: d2nyba1, d2nybb1, d2nybc1, d2nybd1
   automatically matched to d1isaa2
   complexed with fe2, o; mutant

Details for d2nybd2

PDB Entry: 2nyb, 1.1 Å

PDB Description: crystal structure of e.coli iron superoxide dismutase q69e at 1.1 angstrom resolution

PDB Compounds: (D:) superoxide dismutase [fe]

SCOP Domain Sequences for d2nybd2:

Sequence; same for both SEQRES and ATOM records:

>d2nybd2 d.44.1.1 (D:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

Timeline for d2nybd2:

• d2nybd2 is new in SCOP 1.73
  
• d2nybd2 appears in SCOP 1.75
  
• d2nybd2 appears in the current release, SCOPe 2.08