SCOPe 2.05: Domain d2ny7l2: 2ny7 L:108-214

Lineage for d2ny7l2 (2ny7 L:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d2ny7l2: 2ny7 L:108-214 [138803]
   Other proteins in same PDB: d2ny7g_, d2ny7h1, d2ny7h2, d2ny7l1
   automated match to d1n0xl2
   complexed with nag

Details for d2ny7l2

PDB Entry: 2ny7, 2.3 Å

PDB Description: hiv-1 gp120 envelope glycoprotein complexed with the broadly neutralizing cd4-binding-site antibody b12

PDB Compounds: (L:) ANTIBODY b12, LIGHT CHAIN

SCOPe Domain Sequences for d2ny7l2:

Sequence; same for both SEQRES and ATOM records:

>d2ny7l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

Timeline for d2ny7l2:

• d2ny7l2 first appeared in SCOP 1.73
  
• d2ny7l2 appears in SCOPe 2.04
  
• d2ny7l2 appears in SCOPe 2.06
  
• d2ny7l2 appears in the current release, SCOPe 2.08