SCOPe 2.05: Domain d2ny7l1: 2ny7 L:1-107

Lineage for d2ny7l1 (2ny7 L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)

8. Domain d2ny7l1: 2ny7 L:1-107 [138802]
   Other proteins in same PDB: d2ny7g_, d2ny7h1, d2ny7h2, d2ny7l2
   automated match to d1n0xl1
   complexed with nag

Details for d2ny7l1

PDB Entry: 2ny7, 2.3 Å

PDB Description: hiv-1 gp120 envelope glycoprotein complexed with the broadly neutralizing cd4-binding-site antibody b12

PDB Compounds: (L:) ANTIBODY b12, LIGHT CHAIN

SCOPe Domain Sequences for d2ny7l1:

Sequence; same for both SEQRES and ATOM records:

>d2ny7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

Timeline for d2ny7l1:

• d2ny7l1 first appeared in SCOP 1.73
  
• d2ny7l1 appears in SCOPe 2.04
  
• d2ny7l1 appears in SCOPe 2.06
  
• d2ny7l1 appears in the current release, SCOPe 2.08