| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d2ny5l2: 2ny5 L:2110-2214 [138793] Other proteins in same PDB: d2ny5c1, d2ny5c2, d2ny5h1, d2ny5h2, d2ny5l1 automatically matched to d1g9ml2 complexed with nag, suc; mutant |
PDB Entry: 2ny5 (more details), 2.5 Å
SCOP Domain Sequences for d2ny5l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny5l2 b.1.1.2 (L:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d2ny5l2:
View in 3DDomains from other chains: (mouse over for more information) d2ny5c1, d2ny5c2, d2ny5h1, d2ny5h2 |