Lineage for d2ny5c2 (2ny5 C:1098-1181)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031444Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2031454Protein CD4 C2-set domains [49149] (2 species)
  7. 2031455Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)
  8. 2031467Domain d2ny5c2: 2ny5 C:1098-1181 [138789]
    Other proteins in same PDB: d2ny5c1, d2ny5g1, d2ny5h1, d2ny5h2, d2ny5l1, d2ny5l2
    complexed with nag, suc

Details for d2ny5c2

PDB Entry: 2ny5 (more details), 2.5 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t257s, v275c, s334a, s375w, q428c, a433m) complexed with cd4 and antibody 17b
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny5c2 b.1.1.3 (C:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOPe Domain Coordinates for d2ny5c2:

Click to download the PDB-style file with coordinates for d2ny5c2.
(The format of our PDB-style files is described here.)

Timeline for d2ny5c2: