SCOPe 2.02: Domain d2ny5c1: 2ny5 C:1001-1097

Lineage for d2ny5c1 (2ny5 C:1001-1097)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries)

8. Domain d2ny5c1: 2ny5 C:1001-1097 [138788]
   Other proteins in same PDB: d2ny5c2, d2ny5g1, d2ny5h1, d2ny5h2, d2ny5l1, d2ny5l2
   automatically matched to d1cdi_1
   complexed with nag, suc

Details for d2ny5c1

PDB Entry: 2ny5, 2.5 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t257s, v275c, s334a, s375w, q428c, a433m) complexed with cd4 and antibody 17b

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny5c1:

Sequence; same for both SEQRES and ATOM records:

>d2ny5c1 b.1.1.1 (C:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d2ny5c1:

• d2ny5c1 first appeared in SCOP 1.73
  
• d2ny5c1 appears in SCOPe 2.01
  
• d2ny5c1 appears in SCOPe 2.03
  
• d2ny5c1 appears in the current release, SCOPe 2.08