Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries) |
Domain d2ny5c1: 2ny5 C:1001-1097 [138788] Other proteins in same PDB: d2ny5c2, d2ny5g1, d2ny5h1, d2ny5h2, d2ny5l1, d2ny5l2 automatically matched to d1cdi_1 complexed with nag, suc; mutant |
PDB Entry: 2ny5 (more details), 2.5 Å
SCOP Domain Sequences for d2ny5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny5c1 b.1.1.1 (C:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d2ny5c1: