Lineage for d2ny3c2 (2ny3 C:2112-2214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360179Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2360180Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2360259Domain d2ny3c2: 2ny3 C:2112-2214 [138779]
    Other proteins in same PDB: d2ny3a1, d2ny3b1, d2ny3b2, d2ny3c1, d2ny3d1, d2ny3d2
    automated match to d1rz8a2
    complexed with nag, suc

Details for d2ny3c2

PDB Entry: 2ny3 (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (k231c, t257s, e267c, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOPe Domain Sequences for d2ny3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny3c2 b.1.1.2 (C:2112-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d2ny3c2:

Click to download the PDB-style file with coordinates for d2ny3c2.
(The format of our PDB-style files is described here.)

Timeline for d2ny3c2: