Lineage for d2ny3b1 (2ny3 B:1001-1097)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352553Protein CD4 V-set domains [48737] (2 species)
  7. 2352554Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)
  8. 2352564Domain d2ny3b1: 2ny3 B:1001-1097 [138776]
    Other proteins in same PDB: d2ny3a1, d2ny3b2, d2ny3c1, d2ny3c2, d2ny3d1, d2ny3d2
    complexed with nag, suc

Details for d2ny3b1

PDB Entry: 2ny3 (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (k231c, t257s, e267c, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny3b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d2ny3b1:

Click to download the PDB-style file with coordinates for d2ny3b1.
(The format of our PDB-style files is described here.)

Timeline for d2ny3b1: