SCOPe 2.07: Domain d2ny2b2: 2ny2 B:1098-1181

Lineage for d2ny2b2 (2ny2 B:1098-1181)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)

8. Domain d2ny2b2: 2ny2 B:1098-1181 [138771]
   Other proteins in same PDB: d2ny2a1, d2ny2b1, d2ny2c1, d2ny2c2, d2ny2d1, d2ny2d2
   complexed with edo, hez, nag, suc

Details for d2ny2b2

PDB Entry: 2ny2, 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t123c, t257s, s334a, s375w, g431c) complexed with cd4 and antibody 17b

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny2b2:

Sequence; same for both SEQRES and ATOM records:

>d2ny2b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

Timeline for d2ny2b2:

• d2ny2b2 first appeared in SCOP 1.73
  
• d2ny2b2 appears in SCOPe 2.06
  
• d2ny2b2 appears in the current release, SCOPe 2.08