Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries) |
Domain d2ny2b2: 2ny2 B:1098-1181 [138771] Other proteins in same PDB: d2ny2a1, d2ny2b1, d2ny2c1, d2ny2c2, d2ny2d1, d2ny2d2 automatically matched to d1g9mc2 complexed with edo, hez, nag, suc |
PDB Entry: 2ny2 (more details), 2 Å
SCOPe Domain Sequences for d2ny2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny2b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d2ny2b2: