Lineage for d2ny2b2 (2ny2 B:1098-1181)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935232Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 935242Protein CD4 C2-set domains [49149] (2 species)
  7. 935243Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
  8. 935245Domain d2ny2b2: 2ny2 B:1098-1181 [138771]
    Other proteins in same PDB: d2ny2a1, d2ny2b1, d2ny2c1, d2ny2c2, d2ny2d1, d2ny2d2
    automatically matched to d1g9mc2
    complexed with edo, hez, nag, suc

Details for d2ny2b2

PDB Entry: 2ny2 (more details), 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t123c, t257s, s334a, s375w, g431c) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny2b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOPe Domain Coordinates for d2ny2b2:

Click to download the PDB-style file with coordinates for d2ny2b2.
(The format of our PDB-style files is described here.)

Timeline for d2ny2b2: