SCOP 1.73: Domain d2ny1d2: 2ny1 D:3129-3229

Lineage for d2ny1d2 (2ny1 D:3129-3229)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2ny1d2: 2ny1 D:3129-3229 [138769]
   Other proteins in same PDB: d2ny1b1, d2ny1b2, d2ny1c1, d2ny1c2, d2ny1d1
   automatically matched to d1ngzb2
   complexed with nag, suc; mutant

Details for d2ny1d2

PDB Entry: 2ny1, 1.99 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (i109c, t257s, s334a, s375w, q428c) complexed with cd4 and antibody 17b

PDB Compounds: (D:) antibody 17b, heavy chain

SCOP Domain Sequences for d2ny1d2:

Sequence, based on SEQRES records:

>d2ny1d2 b.1.1.2 (D:3129-3229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d2ny1d2 b.1.1.2 (D:3129-3229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d2ny1d2:

• d2ny1d2 is new in SCOP 1.73
  
• d2ny1d2 appears in SCOP 1.75
  
• d2ny1d2 appears in the current release, SCOPe 2.08