SCOPe 2.01: Domain d2ny1c1: 2ny1 C:2001-2109

Lineage for d2ny1c1 (2ny1 C:2001-2109)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)

8. Domain d2ny1c1: 2ny1 C:2001-2109 [138766]
   Other proteins in same PDB: d2ny1a1, d2ny1b1, d2ny1b2, d2ny1c2, d2ny1d1, d2ny1d2
   automatically matched to d1g9ml1
   complexed with nag, suc

Details for d2ny1c1

PDB Entry: 2ny1, 1.99 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (i109c, t257s, s334a, s375w, q428c) complexed with cd4 and antibody 17b

PDB Compounds: (C:) antibody 17b, light chain

SCOPe Domain Sequences for d2ny1c1:

Sequence; same for both SEQRES and ATOM records:

>d2ny1c1 b.1.1.1 (C:2001-2109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

Timeline for d2ny1c1:

• d2ny1c1 first appeared in SCOP 1.73
  
• d2ny1c1 appears in SCOP 1.75
  
• d2ny1c1 appears in SCOPe 2.02
  
• d2ny1c1 appears in the current release, SCOPe 2.08