Lineage for d2ny0d1 (2ny0 D:3001-3128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739829Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 2739851Domain d2ny0d1: 2ny0 D:3001-3128 [138762]
    Other proteins in same PDB: d2ny0a1, d2ny0b1, d2ny0b2, d2ny0c1, d2ny0c2, d2ny0d2
    automated match to d1rzjh1
    complexed with hez, nag

Details for d2ny0d1

PDB Entry: 2ny0 (more details), 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b
PDB Compounds: (D:) antibody 17b, heavy chain

SCOPe Domain Sequences for d2ny0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny0d1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

SCOPe Domain Coordinates for d2ny0d1:

Click to download the PDB-style file with coordinates for d2ny0d1.
(The format of our PDB-style files is described here.)

Timeline for d2ny0d1: