SCOP 1.73: Domain d2ny0c2: 2ny0 C:2110-2214

Lineage for d2ny0c2 (2ny0 C:2110-2214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2ny0c2: 2ny0 C:2110-2214 [138761]
   Other proteins in same PDB: d2ny0a1, d2ny0b1, d2ny0b2, d2ny0c1, d2ny0d1, d2ny0d2
   automatically matched to d1g9ml2
   complexed with hez, nag; mutant

Details for d2ny0c2

PDB Entry: 2ny0, 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b

PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2ny0c2:

Sequence; same for both SEQRES and ATOM records:

>d2ny0c2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d2ny0c2:

• d2ny0c2 is new in SCOP 1.73
  
• d2ny0c2 appears in SCOP 1.75
  
• d2ny0c2 appears in the current release, SCOPe 2.08