Lineage for d2ny0c1 (2ny0 C:2001-2109)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782793Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 782807Domain d2ny0c1: 2ny0 C:2001-2109 [138760]
    Other proteins in same PDB: d2ny0a1, d2ny0b1, d2ny0b2, d2ny0c2, d2ny0d1, d2ny0d2
    automatically matched to d1g9ml1
    complexed with hez, nag; mutant

Details for d2ny0c1

PDB Entry: 2ny0 (more details), 2.2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, t257s, v275c, s334a, s375w, a433m) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2ny0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny0c1 b.1.1.1 (C:2001-2109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik

SCOP Domain Coordinates for d2ny0c1:

Click to download the PDB-style file with coordinates for d2ny0c1.
(The format of our PDB-style files is described here.)

Timeline for d2ny0c1: