Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries) |
Domain d2ny0b1: 2ny0 B:1001-1097 [138758] Other proteins in same PDB: d2ny0a1, d2ny0b2, d2ny0c1, d2ny0c2, d2ny0d1, d2ny0d2 complexed with hez, nag |
PDB Entry: 2ny0 (more details), 2.2 Å
SCOPe Domain Sequences for d2ny0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny0b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d2ny0b1: