SCOPe 2.04: Domain d2nxyd1: 2nxy D:3001-3128

Lineage for d2nxyd1 (2nxy D:3001-3128)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d2nxyd1: 2nxy D:3001-3128 [138749]
   Other proteins in same PDB: d2nxya1, d2nxyb1, d2nxyb2, d2nxyc1, d2nxyc2, d2nxyd2
   automated match to d1rzjh1
   complexed with hez, nag, trs

Details for d2nxyd1

PDB Entry: 2nxy, 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b

PDB Compounds: (D:) antibody 17b, heavy chain

SCOPe Domain Sequences for d2nxyd1:

Sequence; same for both SEQRES and ATOM records:

>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

Timeline for d2nxyd1:

• d2nxyd1 first appeared in SCOP 1.73
  
• d2nxyd1 appears in SCOPe 2.03
  
• d2nxyd1 appears in SCOPe 2.05
  
• d2nxyd1 appears in the current release, SCOPe 2.08