![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (157 PDB entries) |
![]() | Domain d2nx5r1: 2nx5 R:1-99 [138738] Other proteins in same PDB: d2nx5a1, d2nx5a2, d2nx5f1, d2nx5f2, d2nx5k1, d2nx5k2, d2nx5q1, d2nx5q2 automatically matched to d1a9bb_ |
PDB Entry: 2nx5 (more details), 2.7 Å
SCOP Domain Sequences for d2nx5r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nx5r1 b.1.1.2 (R:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2nx5r1: