SCOPe 2.01: Domain d2nx5q2: 2nx5 Q:1-181

Lineage for d2nx5q2 (2nx5 Q:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)

8. Domain d2nx5q2: 2nx5 Q:1-181 [138737]
   Other proteins in same PDB: d2nx5a1, d2nx5b_, d2nx5f1, d2nx5g_, d2nx5k1, d2nx5l_, d2nx5q1, d2nx5r_
   automatically matched to d1a1ma2

Details for d2nx5q2

PDB Entry: 2nx5, 2.7 Å

PDB Description: crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a

PDB Compounds: (Q:) hla-b35

SCOPe Domain Sequences for d2nx5q2:

Sequence; same for both SEQRES and ATOM records:

>d2nx5q2 d.19.1.1 (Q:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d2nx5q2:

• d2nx5q2 first appeared in SCOP 1.73
  
• d2nx5q2 appears in SCOP 1.75
  
• d2nx5q2 appears in SCOPe 2.02
  
• d2nx5q2 appears in the current release, SCOPe 2.08