SCOP 1.73: Domain d2nx5f1: 2nx5 F:182-276

Lineage for d2nx5f1 (2nx5 F:182-276)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d2nx5f1: 2nx5 F:182-276 [138730]
   Other proteins in same PDB: d2nx5a2, d2nx5b1, d2nx5f2, d2nx5g1, d2nx5k2, d2nx5l1, d2nx5q2, d2nx5r1
   automatically matched to d1a1ma1

Details for d2nx5f1

PDB Entry: 2nx5, 2.7 Å

PDB Description: crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a

PDB Compounds: (F:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOP Domain Sequences for d2nx5f1:

Sequence; same for both SEQRES and ATOM records:

>d2nx5f1 b.1.1.2 (F:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d2nx5f1:

• d2nx5f1 is new in SCOP 1.73
  
• d2nx5f1 appears in SCOP 1.75
  
• d2nx5f1 appears in the current release, SCOPe 2.08