Lineage for d2nx5a1 (2nx5 A:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654700Domain d2nx5a1: 2nx5 A:182-276 [138727]
    Other proteins in same PDB: d2nx5a2, d2nx5b1, d2nx5f2, d2nx5g1, d2nx5k2, d2nx5l1, d2nx5q2, d2nx5r1
    automatically matched to d1a1ma1

Details for d2nx5a1

PDB Entry: 2nx5 (more details), 2.7 Å

PDB Description: crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOP Domain Sequences for d2nx5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nx5a1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d2nx5a1:

Click to download the PDB-style file with coordinates for d2nx5a1.
(The format of our PDB-style files is described here.)

Timeline for d2nx5a1: