Lineage for d2nwdx1 (2nwd X:1-130)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714022Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 714086Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 714393Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)
  8. 714394Domain d2nwdx1: 2nwd X:1-130 [138718]
    automatically matched to d1c7pa_

Details for d2nwdx1

PDB Entry: 2nwd (more details), 1.04 Å

PDB Description: Structure of chemically synthesized human lysozyme at 1 Angstrom resolution
PDB Compounds: (X:) Lysozyme C

SCOP Domain Sequences for d2nwdx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwdx1 d.2.1.2 (X:1-130) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d2nwdx1:

Click to download the PDB-style file with coordinates for d2nwdx1.
(The format of our PDB-style files is described here.)

Timeline for d2nwdx1: