Lineage for d2nvyf1 (2nvy F:72-155)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100304Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1100305Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1100342Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 1100343Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 1100344Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 1100358Domain d2nvyf1: 2nvy F:72-155 [138686]
    Other proteins in same PDB: d2nvya1, d2nvyb1, d2nvyc1, d2nvyc2, d2nvye1, d2nvye2, d2nvyh1, d2nvyi1, d2nvyi2, d2nvyj1, d2nvyk1, d2nvyl1
    automatically matched to d1i3qf_
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d2nvyf1

PDB Entry: 2nvy (more details), 3.4 Å

PDB Description: RNA Polymerase II form II in 150 mM Mn+2
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2nvyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvyf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d2nvyf1:

Click to download the PDB-style file with coordinates for d2nvyf1.
(The format of our PDB-style files is described here.)

Timeline for d2nvyf1: