SCOPe 2.02: Domain d2nvxi2: 2nvx I:50-120

Lineage for d2nvxi2 (2nvx I:50-120)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d2nvxi2: 2nvx I:50-120 [138676]
   Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxj1, d2nvxk1, d2nvxl1
   automatically matched to d1i3qi2
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxi2

PDB Entry: 2nvx, 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2nvxi2:

Sequence; same for both SEQRES and ATOM records:

>d2nvxi2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

Timeline for d2nvxi2:

• d2nvxi2 first appeared in SCOP 1.73
  
• d2nvxi2 appears in SCOPe 2.01
  
• d2nvxi2 appears in SCOPe 2.03
  
• d2nvxi2 appears in the current release, SCOPe 2.08