Lineage for d2nvwa2 (2nvw A:155-373)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527649Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2527650Protein Galactose/lactose metabolism regulatory protein GAL80 [143546] (1 species)
  7. 2527651Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [143547] (2 PDB entries)
    Uniprot Q06433 155-373
  8. 2527652Domain d2nvwa2: 2nvw A:155-373 [138666]
    Other proteins in same PDB: d2nvwa1, d2nvwa3

Details for d2nvwa2

PDB Entry: 2nvw (more details), 2.1 Å

PDB Description: Crystal sctucture of transcriptional regulator Gal80p from kluyveromymes lactis
PDB Compounds: (A:) Galactose/lactose metabolism regulatory protein GAL80

SCOPe Domain Sequences for d2nvwa2:

Sequence, based on SEQRES records: (download)

>d2nvwa2 d.81.1.5 (A:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkv
pvscsfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngngssng
tdnngaaaikdkekvtkspspstgtseeeqtmevfhlrn

Sequence, based on observed residues (ATOM records): (download)

>d2nvwa2 d.81.1.5 (A:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldgkrtketisktcpdhllfqgilengkvpv
scsfkggtpvkkltknlvidihgtkgdlkiegdsnlvlyfygikngeeqtmevfhlrn

SCOPe Domain Coordinates for d2nvwa2:

Click to download the PDB-style file with coordinates for d2nvwa2.
(The format of our PDB-style files is described here.)

Timeline for d2nvwa2: