Lineage for d2nvuj_ (2nvu J:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177392Protein Nedd8 [54244] (1 species)
  7. 2177393Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2177412Domain d2nvuj_: 2nvu J: [138664]
    Other proteins in same PDB: d2nvua_, d2nvub1, d2nvub2, d2nvuc1
    automated match to d1nddb_
    complexed with atp, mg, zn

Details for d2nvuj_

PDB Entry: 2nvu (more details), 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
PDB Compounds: (J:) nedd8

SCOPe Domain Sequences for d2nvuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvuj_ d.15.1.1 (J:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOPe Domain Coordinates for d2nvuj_:

Click to download the PDB-style file with coordinates for d2nvuj_.
(The format of our PDB-style files is described here.)

Timeline for d2nvuj_: