Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) |
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
Protein Nedd8 [54244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54245] (6 PDB entries) Uniprot Q15843 |
Domain d2nvuj1: 2nvu J:1-76 [138664] Other proteins in same PDB: d2nvua1, d2nvub1, d2nvub2, d2nvuc1 automatically matched to d1nddb_ complexed with atp, mg, zn; mutant |
PDB Entry: 2nvu (more details), 2.8 Å
SCOP Domain Sequences for d2nvuj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvuj1 d.15.1.1 (J:1-76) Nedd8 {Human (Homo sapiens) [TaxId: 9606]} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlalrgg
Timeline for d2nvuj1: