Lineage for d2nvqe2 (2nvq E:144-215)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865615Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 865616Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 865617Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 865618Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 865619Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 865626Domain d2nvqe2: 2nvq E:144-215 [138639]
    Other proteins in same PDB: d2nvqa1, d2nvqb1, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqf1, d2nvqh1, d2nvqi1, d2nvqi2, d2nvqj1, d2nvqk1, d2nvql1
    automatically matched to d1dzfa2
    complexed with dut, mg, zn

Details for d2nvqe2

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2nvqe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d2nvqe2:

Click to download the PDB-style file with coordinates for d2nvqe2.
(The format of our PDB-style files is described here.)

Timeline for d2nvqe2: