SCOPe 2.08: Domain d2ntwa_: 2ntw A:

Lineage for d2ntwa_ (2ntw A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Bacteriorhodopsin [56871] (3 species)
   a light-driven proton pump

7. Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries)
   Uniprot P02945 17-245

8. Domain d2ntwa_: 2ntw A: [138596]
   automated match to d1cwqa_
   complexed with ret

Details for d2ntwa_

PDB Entry: 2ntw, 1.53 Å

PDB Description: Bacteriorhodopsin, wild type, after illumination to produce the L intermediate

PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d2ntwa_:

Sequence, based on SEQRES records:

>d2ntwa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Sequence, based on observed residues (ATOM records):

>d2ntwa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
ligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d2ntwa_:

• d2ntwa_ first appeared in SCOP 1.73, called d2ntwa1
  
• d2ntwa_ appears in SCOPe 2.07