SCOPe 2.08: Domain d2nsub1: 2nsu B:609-760

Lineage for d2nsub1 (2nsu B:609-760)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family)
   automatically mapped to Pfam PF04253

5. Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)

6. Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47675] (4 PDB entries)

8. Domain d2nsub1: 2nsu B:609-760 [138549]
   Other proteins in same PDB: d2nsua2, d2nsua3, d2nsub2, d2nsub3
   automatically matched to d1cx8a1

Details for d2nsub1

PDB Entry: 2nsu, 27 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor fitted into a cryo-em reconstruction of canine parvovirus and feline transferrin receptor complex

PDB Compounds: (B:) Transferrin receptor protein 1

SCOPe Domain Sequences for d2nsub1:

Sequence; same for both SEQRES and ATOM records:

>d2nsub1 a.48.2.1 (B:609-760) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr
fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne
tlfrnqlalatwtiqgaanalsgdvwdidnef

Timeline for d2nsub1:

• d2nsub1 first appeared in SCOP 1.73
  
• d2nsub1 appears in SCOPe 2.07