SCOPe 2.08: Domain d2nrhb1: 2nrh B:2-82

Lineage for d2nrhb1 (2nrh B:2-82)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.13: CoaX-like [142484] (1 protein)
   Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf

6. Protein Type III pantothenate kinase, CoaX [142485] (3 species)

7. Species Campylobacter jejuni [TaxId:197] [142488] (1 PDB entry)
   Uniprot Q5HW73 1-82! Uniprot Q5HW73 83-208

8. Domain d2nrhb1: 2nrh B:2-82 [138525]
   Other proteins in same PDB: d2nrha3, d2nrhb3
   automated match to d2nrha1
   complexed with so4

Details for d2nrhb1

PDB Entry: 2nrh, 2.3 Å

PDB Description: crystal structure of conserved putative baf family transcriptional activator from campylobacter jejuni

PDB Compounds: (B:) Transcriptional activator, putative, Baf family

SCOPe Domain Sequences for d2nrhb1:

Sequence, based on SEQRES records:

>d2nrhb1 c.55.1.13 (B:2-82) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
llcdignsnanflddnkyftlnidqflefkneqkifyinvnehlkehlknqknfinlepy
flfdtiyqglgidriaacyti

Sequence, based on observed residues (ATOM records):

>d2nrhb1 c.55.1.13 (B:2-82) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
llcdignsnanfldkyftlnidqflefknqkifyinvnehlkehlknqknfinlepyflf
dtiyqglgidriaacyti

Timeline for d2nrhb1:

• d2nrhb1 first appeared in SCOP 1.73
  
• d2nrhb1 appears in SCOPe 2.07