| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (22 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) |
| Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species) includes the N-terminal 'sequence' domain I |
| Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries) Uniprot P97571 33-353 |
| Domain d2nqia1: 2nqi A:33-354 [138454] automatically matched to d1tloa_ complexed with ca, nqi |
PDB Entry: 2nqi (more details), 2.04 Å
SCOP Domain Sequences for d2nqia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqia1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnlt
Timeline for d2nqia1: