Lineage for d2nqia1 (2nqi A:33-354)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851562Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
  6. 851563Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
    includes the N-terminal 'sequence' domain I
  7. 851578Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries)
    Uniprot P97571 33-353
  8. 851587Domain d2nqia1: 2nqi A:33-354 [138454]
    automatically matched to d1tloa_
    complexed with ca, nqi

Details for d2nqia1

PDB Entry: 2nqi (more details), 2.04 Å

PDB Description: calpain 1 proteolytic core inactivated by wr13(r,r), an epoxysuccinyl- type inhibitor.
PDB Compounds: (A:) Calpain-1 catalytic subunit

SCOP Domain Sequences for d2nqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqia1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnlt

SCOP Domain Coordinates for d2nqia1:

Click to download the PDB-style file with coordinates for d2nqia1.
(The format of our PDB-style files is described here.)

Timeline for d2nqia1: