Lineage for d2nptd1 (2npt D:42-122)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854100Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 854116Family d.15.2.2: PB1 domain [64225] (10 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 854132Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species)
  7. 854133Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries)
    Uniprot Q9Y2U5 42-123! Uniprot Q9Y2U5 43-132
  8. 854135Domain d2nptd1: 2npt D:42-122 [138451]
    Other proteins in same PDB: d2npta1, d2nptc1
    automatically matched to 2NPT B:42-123

Details for d2nptd1

PDB Entry: 2npt (more details), 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
PDB Compounds: (D:) Mitogen-activated protein kinase kinase kinase 2

SCOP Domain Sequences for d2nptd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nptd1 d.15.2.2 (D:42-122) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]}
ndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldk
avelldrsihmkslkillvin

SCOP Domain Coordinates for d2nptd1:

Click to download the PDB-style file with coordinates for d2nptd1.
(The format of our PDB-style files is described here.)

Timeline for d2nptd1: