Lineage for d2nptc_ (2npt C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195424Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1195440Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 1195450Protein Mitogen activated protein kinase kinase 5, Map2k5 [117827] (2 species)
  7. 1195451Species Human (Homo sapiens) [TaxId:9606] [142975] (2 PDB entries)
    Uniprot Q13163 4-108
  8. 1195453Domain d2nptc_: 2npt C: [138450]
    Other proteins in same PDB: d2nptb1, d2nptd_
    automated match to d1wi0a_

Details for d2nptc_

PDB Entry: 2npt (more details), 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
PDB Compounds: (C:) Dual specificity mitogen-activated protein kinase kinase 5

SCOPe Domain Sequences for d2nptc_:

Sequence, based on SEQRES records: (download)

>d2nptc_ d.15.2.2 (C:) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
smalgpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafey
ededgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

Sequence, based on observed residues (ATOM records): (download)

>d2nptc_ d.15.2.2 (C:) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
smalgpfpamenqvlvirikipnsgavdwtvhqllfrdvldvigqvlpeatttafeyede
dgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

SCOPe Domain Coordinates for d2nptc_:

Click to download the PDB-style file with coordinates for d2nptc_.
(The format of our PDB-style files is described here.)

Timeline for d2nptc_: