SCOP 1.75: Domain d2nptc1: 2npt C:4-108

Lineage for d2nptc1 (2npt C:4-108)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (10 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Mitogen activated protein kinase kinase 5, Map2k5 [117827] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142975] (1 PDB entry)
   Uniprot Q13163 4-108

8. Domain d2nptc1: 2npt C:4-108 [138450]
   Other proteins in same PDB: d2nptb1, d2nptd1
   automatically matched to 2NPT A:4-108

Details for d2nptc1

PDB Entry: 2npt, 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)

PDB Compounds: (C:) Dual specificity mitogen-activated protein kinase kinase 5

SCOP Domain Sequences for d2nptc1:

Sequence, based on SEQRES records:

>d2nptc1 d.15.2.2 (C:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
malgpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafeye
dedgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

Sequence, based on observed residues (ATOM records):

>d2nptc1 d.15.2.2 (C:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
malgpfpamenqvlvirikipnsgavdwtvhqllfrdvldvigqvlpeatttafeyeded
gdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

Timeline for d2nptc1:

• d2nptc1 first appeared in SCOP 1.73
  
• d2nptc1 is called d2nptc_ in SCOPe 2.01
  
• d2nptc1 appears in the current release, SCOPe 2.08, called d2nptc2