Lineage for d2npfa3 (2npf A:561-725)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. Protein Elongation factor 2 (eEF-2), domain IV [82575] (2 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
    Uniprot P32324
  8. Domain d2npfa3: 2npf A:561-725 [138434]
    Other proteins in same PDB: d2npfa1, d2npfa2, d2npfa4, d2npfa5, d2npfb1, d2npfb2, d2npfb4, d2npfb5
    automated match to d1n0ua3
    complexed with gdp, mou

Details for d2npfa3

PDB Entry: 2npf (more details), 2.9 Å

PDB Description: structure of eef2 in complex with moriniafungin
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2npfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2npfa3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d2npfa3 are not available.

Timeline for d2npfa3:

Domains from same chain:
(mouse over for more information)
d2npfa1, d2npfa2, d2npfa4, d2npfa5
Domains from other chains:
(mouse over for more information)
d2npfb1, d2npfb2, d2npfb3, d2npfb4, d2npfb5