Lineage for d2np0a4 (2np0 A:534-861)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2268037Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2268051Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 2268052Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 2268053Protein Botulinum neurotoxin [58093] (2 species)
  7. 2268059Species Clostridium botulinum, serotype B [TaxId:1491] [58095] (14 PDB entries)
  8. 2268070Domain d2np0a4: 2np0 A:534-861 [138419]
    Other proteins in same PDB: d2np0a1, d2np0a2, d2np0a3
    automated match to d1epwa4
    complexed with ca, cl, zn

Details for d2np0a4

PDB Entry: 2np0 (more details), 2.62 Å

PDB Description: Crystal structure of the Botulinum neurotoxin type B complexed with synaptotagamin-II ectodomain
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d2np0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np0a4 h.4.2.1 (A:534-861) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
ntifqylysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwv
kqivndfvieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillef
ipellipvvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfyt
ikegmykalnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnf
ingcsvsylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylkt
impfdlsiytndtiliemfnkynseiln

SCOPe Domain Coordinates for d2np0a4:

Click to download the PDB-style file with coordinates for d2np0a4.
(The format of our PDB-style files is described here.)

Timeline for d2np0a4: