SCOPe 2.04: Domain d2nmxb_: 2nmx B:

Lineage for d2nmxb_ (2nmx B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)

8. Domain d2nmxb_: 2nmx B: [138383]
   automated match to d1bzm__
   complexed with m25, na, trs, zn

Details for d2nmxb_

PDB Entry: 2nmx, 1.55 Å

PDB Description: structure of inhibitor binding to carbonic anhydrase i

PDB Compounds: (B:) Carbonic anhydrase 1

SCOPe Domain Sequences for d2nmxb_:

Sequence; same for both SEQRES and ATOM records:

>d2nmxb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

Timeline for d2nmxb_:

• d2nmxb_ first appeared in SCOP 1.73, called d2nmxb1
  
• d2nmxb_ appears in SCOPe 2.03
  
• d2nmxb_ appears in SCOPe 2.05
  
• d2nmxb_ appears in the current release, SCOPe 2.08