Lineage for d2nmqa_ (2nmq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934799Species Streptococcus sp. [TaxId:1320] [255506] (3 PDB entries)
  8. 2934803Domain d2nmqa_: 2nmq A: [138377]
    automated match to d1pgxa_

Details for d2nmqa_

PDB Entry: 2nmq (more details)

PDB Description: simultaneous determination of protein structure and dynamics using rdcs
PDB Compounds: (A:) Immunoglobulin G-binding protein G precursor

SCOPe Domain Sequences for d2nmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nmqa_ d.15.7.1 (A:) automated matches {Streptococcus sp. [TaxId: 1320]}
tyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte

SCOPe Domain Coordinates for d2nmqa_:

Click to download the PDB-style file with coordinates for d2nmqa_.
(The format of our PDB-style files is described here.)

Timeline for d2nmqa_: