SCOPe 2.04: Domain d2jqaa1: 2jqa A:1-149

Lineage for d2jqaa1 (2jqa A:1-149)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.10: DR1885-like metal-binding protein [110087] (1 family)

5. Family b.2.10.1: DR1885-like metal-binding protein [110088] (1 protein)
   Pfam PF04314

6. Protein Hypothetical protein DR1885 [110089] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries)
   Uniprot Q9RT80 35-178

8. Domain d2jqaa1: 2jqa A:1-149 [138361]
   automatically matched to d1x7la_

Details for d2jqaa1

PDB Entry: 2jqa

PDB Description: Solution structure of apo-DR1885 from Deinococcus radiodurans

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2jqaa1:

Sequence; same for both SEQRES and ATOM records:

>d2jqaa1 b.2.10.1 (A:1-149) Hypothetical protein DR1885 {Deinococcus radiodurans [TaxId: 1299]}
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkniegr

Timeline for d2jqaa1:

• d2jqaa1 first appeared in SCOP 1.73
  
• d2jqaa1 appears in SCOPe 2.03
  
• d2jqaa1 appears in SCOPe 2.05
  
• d2jqaa1 appears in the current release, SCOPe 2.08