SCOP 1.75: Domain d2jefa1: 2jef A:241-341

Lineage for d2jefa1 (2jef A:241-341)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)

8. Domain d2jefa1: 2jef A:241-341 [138278]
   Other proteins in same PDB: d2jefa2
   automatically matched to d1n48a1
   complexed with bzg, ca, dgt, doc

Details for d2jefa1

PDB Entry: 2jef, 2.17 Å

PDB Description: the molecular basis of selectivity of nucleotide triphosphate incorporation opposite o6-benzylguanine by sulfolobus solfataricus dna polymerase iv: steady-state and pre-steady-state and x-ray crystallography of correct and incorrect pairing

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2jefa1:

Sequence; same for both SEQRES and ATOM records:

>d2jefa1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2jefa1:

• d2jefa1 first appeared in SCOP 1.73
  
• d2jefa1 appears in SCOPe 2.01
  
• d2jefa1 appears in the current release, SCOPe 2.08