Lineage for d2jdih2 (2jdi H:17-101)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1140512Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 1140513Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 1140514Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)
  6. 1140515Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)
    delta subunit in mitochondria
  7. 1140516Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)
  8. 1140517Domain d2jdih2: 2jdi H:17-101 [138274]
    Other proteins in same PDB: d2jdia1, d2jdia2, d2jdia3, d2jdib1, d2jdib2, d2jdib3, d2jdic1, d2jdic2, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdii_
    automatically matched to d1h8eh_
    complexed with anp, mg

Details for d2jdih2

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (H:) ATP synthase delta chain

SCOPe Domain Sequences for d2jdih2:

Sequence, based on SEQRES records: (download)

>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttskyf
vssgsvtvnadssvqllaeeavtld

Sequence, based on observed residues (ATOM records): (download)

>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
sftfasptqvffnqvdvptlrpglvvvfvssgsqllaeeavtld

SCOPe Domain Coordinates for d2jdih2:

Click to download the PDB-style file with coordinates for d2jdih2.
(The format of our PDB-style files is described here.)

Timeline for d2jdih2: