Class b: All beta proteins [48724] (174 folds) |
Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) |
Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein) |
Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species) delta subunit in mitochondria |
Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries) |
Domain d2jdih2: 2jdi H:17-101 [138274] Other proteins in same PDB: d2jdia1, d2jdia2, d2jdia3, d2jdib1, d2jdib2, d2jdib3, d2jdic1, d2jdic2, d2jdic3, d2jdid1, d2jdid2, d2jdid3, d2jdie1, d2jdie2, d2jdie3, d2jdif1, d2jdif2, d2jdif3, d2jdig_, d2jdih1, d2jdii_ automatically matched to d1h8eh_ complexed with anp, mg |
PDB Entry: 2jdi (more details), 1.9 Å
SCOPe Domain Sequences for d2jdih2:
Sequence, based on SEQRES records: (download)
>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} sftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttskyf vssgsvtvnadssvqllaeeavtld
>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} sftfasptqvffnqvdvptlrpglvvvfvssgsqllaeeavtld
Timeline for d2jdih2: