SCOP 1.73: Domain d2jcfb1: 2jcf B:1083-1359

Lineage for d2jcfb1 (2jcf B:1083-1359)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)

6. Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64133] (18 PDB entries)

8. Domain d2jcfb1: 2jcf B:1083-1359 [138257]
   automatically matched to d1g8oa_
   complexed with gol, mn, up1; mutant

Details for d2jcfb1

PDB Entry: 2jcf, 2.4 Å

PDB Description: crystal structure of alpha-1,3 galactosyltransferase (r365k) in complex with udp-2f-galactose

PDB Compounds: (B:) n-acetyllactosaminide alpha-1,3-galactosyl transferase

SCOP Domain Sequences for d2jcfb1:

Sequence; same for both SEQRES and ATOM records:

>d2jcfb1 c.68.1.9 (B:1083-1359) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
lklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryieh
yleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismmr
mktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftyer
rkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshlnk
yfllnkptkilspeycwdyhiglpadiklvkmswqtk

Timeline for d2jcfb1:

• d2jcfb1 is new in SCOP 1.73
  
• d2jcfb1 does not appear in SCOP 1.75