SCOP 1.73: Domain d2ja8g1: 2ja8 G:81-171

Lineage for d2ja8g1 (2ja8 G:81-171)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)

8. Domain d2ja8g1: 2ja8 G:81-171 [138230]
   Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
   automatically matched to d1y14b1
   complexed with bru, mg, tt, zn

Details for d2ja8g1

PDB Entry: 2ja8, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d

PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOP Domain Sequences for d2ja8g1:

Sequence; same for both SEQRES and ATOM records:

>d2ja8g1 b.40.4.5 (G:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

Timeline for d2ja8g1:

• d2ja8g1 is new in SCOP 1.73
  
• d2ja8g1 appears in SCOP 1.75
  
• d2ja8g1 appears in the current release, SCOPe 2.08